Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD6 Peptide - C-terminal region

PSMD6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S10, Rpn7, p42A, p44S10, SGA-113M

UniProt

Q15008

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ41423 Adenovirus (Human)
20651051 1.0 mL

FLJ41423 Adenovirus (Human)

Sign In for Pricing
View Details
C-FER Mouse Monoclonal Antibody
E38QA9201 100 µL

C-FER Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Activin Receptor Type IA (ACVR1) (NM_001105) Human Tagged Lenti ORF Clone
RC207486L2 10 µg

Activin Receptor Type IA (ACVR1) (NM_001105) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cefotiam Impurity 31
RM-C061331-01 10 mg

Cefotiam Impurity 31

Sign In for Pricing
View Details
Cefotiam Impurity 31
RM-C061331-02 25 mg

Cefotiam Impurity 31

Sign In for Pricing
View Details
Cefotiam Impurity 31
RM-C061331-03 50 mg

Cefotiam Impurity 31

Sign In for Pricing
View Details