Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF14 Peptide - C-terminal region

RNF14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARA54, HFB30, TRIAD2, HRIHFB2038

UniProt

Q9UBS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001188294.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maltose Binding Protein / MBP-probe (R29.6), CF568 conjugate, 0.1mg/mL
BNC682847-500 1x 500 µL

Maltose Binding Protein / MBP-probe (R29.6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Swine CXCL9 protein (His Tag)
PKSS000021-01 5 µg

Recombinant Swine CXCL9 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Swine CXCL9 protein (His Tag)
PKSS000021-02 20 µg

Recombinant Swine CXCL9 protein (His Tag)

Sign In for Pricing
View Details
Ferritin Conjugated Glycine max Lectin (Soybean) -SBA-
I-1301-1 1 mg

Ferritin Conjugated Glycine max Lectin (Soybean) -SBA-

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB524609 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
(S)-(-)-Higenamine Hydrobromide
TRC-H325810-2.5MG 2.5 mg

(S)-(-)-Higenamine Hydrobromide

Sign In for Pricing
View Details