Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASRGL1 Peptide - middle region

ASRGL1 Peptide - middle region

Product Specifications

Product Name Alternative

ALP, ALP1, CRASH

UniProt

Q7L266

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001077395.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Basic Protein (MBP) (NM_001025090) Human Over-expression Lysate
LY422582 100 µg

Myelin Basic Protein (MBP) (NM_001025090) Human Over-expression Lysate

Sign In for Pricing
View Details
FBP1 (N-term) Rabbit Polyclonal Antibody
AP17362PU-N 400 µL

FBP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP10 Recombinant Rabbit Monoclonal Antibody [JU32-62]
ET1706-12 100 µL

USP10 Recombinant Rabbit Monoclonal Antibody [JU32-62]

Sign In for Pricing
View Details
Recombinant Human Chymotrypsin C Protein (His Tag)
PKSH031117 50 µg

Recombinant Human Chymotrypsin C Protein (His Tag)

Sign In for Pricing
View Details
TLR9 Human Gene Knockout Kit (CRISPR)
KN207510RB 1 Kit

TLR9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRX1 Human Gene Knockout Kit (CRISPR)
KN418767 1 Kit

IRX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details