Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASRGL1 Peptide - middle region

ASRGL1 Peptide - middle region

Product Specifications

Product Name Alternative

ALP, ALP1, CRASH

UniProt

Q7L266

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001077395.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC2B (NR_002166) Human Recombinant Protein
TP315934 20 µg

TRAPPC2B (NR_002166) Human Recombinant Protein

Sign In for Pricing
View Details
Human LRMDA activation kit by CRISPRa
GA113317 1 Kit

Human LRMDA activation kit by CRISPRa

Sign In for Pricing
View Details
CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), Biotin conjugate, 0.1mg/mL
BNCB3063-500 1x 500 µL

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS505883 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
PSMD12 Polyclonal Antibody
E-AB-18838-01 20 µL

PSMD12 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD12 Polyclonal Antibody
E-AB-18838-02 60 µL

PSMD12 Polyclonal Antibody

Sign In for Pricing
View Details