BIN3 Peptide - C-terminal region
BIN3 Peptide - C-terminal region
Product Specifications
UniProt
Q9NQY0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_061158.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAKLSEL
More Discoveries
Explore Other Products
Browse additional items from our catalog
RPC30742-01 20 µg
Recombinant Staphylococcus aureus Serine-aspartate repeat-containing protein E (sdrE), partial
Sign In for Pricing
View Details RPC30742-02 100 µg
Recombinant Staphylococcus aureus Serine-aspartate repeat-containing protein E (sdrE), partial
Sign In for Pricing
View Details 
RPC30742-03 1 mg
Recombinant Staphylococcus aureus Serine-aspartate repeat-containing protein E (sdrE), partial
Sign In for Pricing
View Details 47840114 3x 1.0 µg
Trim7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
TL305989V 500 µL Each
C1orf83 (TCEANC2) Human shRNA Lentiviral Particle (Locus ID 127428)
Sign In for Pricing
View Details