BIN3 Peptide - C-terminal region
BIN3 Peptide - C-terminal region
Product Specifications
UniProt
Q9NQY0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_061158.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAKLSEL
More Discoveries
Explore Other Products
Browse additional items from our catalog
IT181218-01 0.1 mg
Tobramycin Impurity 4 dihydrochloride (Mixture of Isomers)
Sign In for Pricing
View Details IT181218-02 0.25 mg
Tobramycin Impurity 4 dihydrochloride (Mixture of Isomers)
Sign In for Pricing
View Details IT181218-03 0.5 mg
Tobramycin Impurity 4 dihydrochloride (Mixture of Isomers)
Sign In for Pricing
View Details IT181218-04 1 mg
Tobramycin Impurity 4 dihydrochloride (Mixture of Isomers)
Sign In for Pricing
View Details