Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH5 Peptide - middle region

DPH5 Peptide - middle region

Product Specifications

Product Name Alternative

AD-018, CGI-30, NPD015, HSPC143

UniProt

Q9H2P9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001070862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMG20B siRNA (Mouse)
orb1847439-01 15 nmol

HMG20B siRNA (Mouse)

Sign In for Pricing
View Details
HMG20B siRNA (Mouse)
orb1847439-02 30 nmol

HMG20B siRNA (Mouse)

Sign In for Pricing
View Details
9 (Z),12 (Z)-Octadecadienoic Acid
MBS392090-01 1 g

9 (Z),12 (Z)-Octadecadienoic Acid

Sign In for Pricing
View Details
9 (Z),12 (Z)-Octadecadienoic Acid
MBS392090-02 10 g

9 (Z),12 (Z)-Octadecadienoic Acid

Sign In for Pricing
View Details
9 (Z),12 (Z)-Octadecadienoic Acid
MBS392090-03 5x 10 g

9 (Z),12 (Z)-Octadecadienoic Acid

Sign In for Pricing
View Details
TAPBPL Protein Vector (Human) (pPM-C-His)
PV041232 500 ng

TAPBPL Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details