Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH5 Peptide - middle region

DPH5 Peptide - middle region

Product Specifications

Product Name Alternative

AD-018, CGI-30, NPD015, HSPC143

UniProt

Q9H2P9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001070862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-374b-5p miRNA Antagomir
CIJ0674-01 10 nmol

Hsa-miR-374b-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-374b-5p miRNA Antagomir
CIJ0674-02 20 nmol

Hsa-miR-374b-5p miRNA Antagomir

Sign In for Pricing
View Details
BCMA/Tnfrsf17 Rabbit Polyclonal Antibody (Fluoro488)
orb3115814 100 µg

BCMA/Tnfrsf17 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Syndecan-1, SDC1 ELISA Kit
MBS944732-01 24 Well (LIMIT 1)

Mouse Syndecan-1, SDC1 ELISA Kit

Sign In for Pricing
View Details
Mouse Syndecan-1, SDC1 ELISA Kit
MBS944732-02 48 Well

Mouse Syndecan-1, SDC1 ELISA Kit

Sign In for Pricing
View Details
Mouse Syndecan-1, SDC1 ELISA Kit
MBS944732-03 96 Well

Mouse Syndecan-1, SDC1 ELISA Kit

Sign In for Pricing
View Details