Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS6 Peptide - C-terminal region

MRPS6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S6mt, RPMS6, MRP-S6, C21orf101

UniProt

P82932

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS6 Rabbit Polyclonal Antibody (orb579604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115865

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fenofibrate Impurity 48
RM-F140248-01 10 mg

Fenofibrate Impurity 48

Sign In for Pricing
View Details
Fenofibrate Impurity 48
RM-F140248-02 100 mg

Fenofibrate Impurity 48

Sign In for Pricing
View Details
Fenofibrate Impurity 48
RM-F140248-03 25 mg

Fenofibrate Impurity 48

Sign In for Pricing
View Details
Fenofibrate Impurity 48
RM-F140248-04 50 mg

Fenofibrate Impurity 48

Sign In for Pricing
View Details
HRH1 Polyclonal Antibody, PE Conjugated
bs-6663R-PE 100 µL

HRH1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
HES6 Antibody
MBS9509565-01 0.05 mL

HES6 Antibody

Sign In for Pricing
View Details