MRPS6 Peptide - C-terminal region
MRPS6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
S6mt, RPMS6, MRP-S6, C21orf101
UniProt
P82932
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS6 Rabbit Polyclonal Antibody (orb579604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_115865
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A04079-Fluoro594 100 µg/Vial
Anti-CHD2 Antibody Picoband® Fluoro594 Conjugated
Sign In for Pricing
View Details 
RDR-FGF21-Hu-48Tests 48 Tests
Human Fibroblast Growth Factor 21 (FGF21) ELISA Kit
Sign In for Pricing
View Details 
orb896929 100 µL
Phospho-EIF4B (Ser422) Rabbit Polyclonal Antibody (PE-Cy5.5)
Sign In for Pricing
View Details