Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD2 Peptide - middle region

CHCHD2 Peptide - middle region

Product Specifications

Product Name Alternative

C7orf17

UniProt

Q9Y6H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057223

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSL1, CT (ACSL1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain-fatty-acid-CoA ligase 1, Acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2) (MaxLight 490) discontinued
031558-ML490 100 µL

ACSL1, CT (ACSL1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain-fatty-acid-CoA ligase 1, Acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
mmu-miR-6416-5p miRNA Agomir
MBS8314517-01 5 nmol

mmu-miR-6416-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6416-5p miRNA Agomir
MBS8314517-02 10 nmol

mmu-miR-6416-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6416-5p miRNA Agomir
MBS8314517-03 20 nmol

mmu-miR-6416-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6416-5p miRNA Agomir
MBS8314517-04 5x 20 nmol

mmu-miR-6416-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse TEX19.2 shRNA Plasmid
abx977333-01 150 µg

Mouse TEX19.2 shRNA Plasmid

Sign In for Pricing
View Details