Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD2 Peptide - middle region

CHCHD2 Peptide - middle region

Product Specifications

Product Name Alternative

C7orf17

UniProt

Q9Y6H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057223

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GROL Recombinant Protein (Chlamydia trachomatis)
OPCA04305-20UG 20 µg

GROL Recombinant Protein (Chlamydia trachomatis)

Sign In for Pricing
View Details
TORC2/CRTC2 Rabbit Polyclonal Antibody (APC)
orb2612580 100 µg

TORC2/CRTC2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
HMGA1L7 CRISPRa sgRNA lentivector (set of three targets)(Human)
59101121 3x 1.0µg DNA

HMGA1L7 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rat PDZ And LIM Domain 4 (PDLIM4) ELISA Kit
abx538270 96 Tests

Rat PDZ And LIM Domain 4 (PDLIM4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal NDUFV2 Antibody [PE]
NBP2-99225PE 0.1 mL

Rabbit Polyclonal NDUFV2 Antibody [PE]

Sign In for Pricing
View Details
Moenomycin complex
sc-362031 5 mg

Moenomycin complex

Sign In for Pricing
View Details