OTUD4 Peptide - C-terminal region
OTUD4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HIN1, DUBA6, HSHIN1
UniProt
Q01804
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001096123.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DWGYSGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDRRRSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9340906-01 48 Well
Human heat shock protein 90kDa beta (Grp94) , member 1 (HSP90B1) ELISA Kit
Sign In for Pricing
View Details MBS9340906-02 96 Well
Human heat shock protein 90kDa beta (Grp94) , member 1 (HSP90B1) ELISA Kit
Sign In for Pricing
View Details MBS9340906-03 5x 96 Well
Human heat shock protein 90kDa beta (Grp94) , member 1 (HSP90B1) ELISA Kit
Sign In for Pricing
View Details MBS9340906-04 10x 96 Well
Human heat shock protein 90kDa beta (Grp94) , member 1 (HSP90B1) ELISA Kit
Sign In for Pricing
View Details 
MBS2506366-01 24 Tests
Rabbit VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
Sign In for Pricing
View Details