Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD4 Peptide - C-terminal region

OTUD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIN1, DUBA6, HSHIN1

UniProt

Q01804

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001096123.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWGYSGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDRRRSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,6-Diaminobenzimidazole Dihydrochloride
TRC-D416201-25MG 25 mg

5,6-Diaminobenzimidazole Dihydrochloride

Sign In for Pricing
View Details
Human Heparanase, Active Protein
RPU60476-01 50 µg

Human Heparanase, Active Protein

Sign In for Pricing
View Details
Human Heparanase, Active Protein
RPU60476-02 100 µg

Human Heparanase, Active Protein

Sign In for Pricing
View Details
Human Heparanase, Active Protein
RPU60476-03 1 mg

Human Heparanase, Active Protein

Sign In for Pricing
View Details
AADACL3 HDR Plasmid (h)
sc-414285-HDR 20 µg

AADACL3 HDR Plasmid (h)

Sign In for Pricing
View Details
Monoclonal Rabbit Anti-Human CDX-2 Antibody
MBS344196-01 0.1 mL (Concentrate)

Monoclonal Rabbit Anti-Human CDX-2 Antibody

Sign In for Pricing
View Details