What is the catalog number for OTUD4 Peptide - C-terminal region?

The catalog number for OTUD4 Peptide - C-terminal region is orb1999663.

What sizes are available for OTUD4 Peptide - C-terminal region?

OTUD4 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is OTUD4 Peptide - C-terminal region in stock?

OTUD4 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

OTUD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIN1, DUBA6, HSHIN1

UniProt

Q01804

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001096123.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWGYSGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDRRRSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM12773VCF 100 µg

PADI4 Mouse Monoclonal Antibody [Clone ID: LBI5B7]

Sign In for Pricing

View Details

Z01LS-1122-LS275 5 Plates

Human SWAP70 Matched Antibody Pair Set [IV11406/Poly]

Sign In for Pricing

View Details

sc-433710-LAC-2 200 µL

RIM-BP3 Lentiviral Activation Particles (m2)

Sign In for Pricing

View Details

orb829993 2 mg

YbcO Antibody

Sign In for Pricing

View Details

TMPH-03078-01 5 µg

CGTases Protein, Paenibacillus macerans, Recombinant (His)

Sign In for Pricing

View Details

TMPH-03078-02 10 µg

CGTases Protein, Paenibacillus macerans, Recombinant (His)

Sign In for Pricing

View Details