Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYTL2 Peptide - middle region

SYTL2 Peptide - middle region

Product Specifications

Product Name Alternative

EXO4, SLP2, SLP2A, SGA72M, CHR11SYT, PPP1R151

UniProt

Q9HCH5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Dkk4 (Dickkopf Related Protein 4) ELISA Kit
FY-EH2228 96 Well

Human Dkk4 (Dickkopf Related Protein 4) ELISA Kit

Sign In for Pricing
View Details
DBC1 Mouse mAb
C05902-100uL*2 2x 100μL

DBC1 Mouse mAb

Sign In for Pricing
View Details
Monkey Anti-Thyroid peroxidase antibody ELISA Kit
MBS750004-01 48 Well

Monkey Anti-Thyroid peroxidase antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Anti-Thyroid peroxidase antibody ELISA Kit
MBS750004-02 96 Well

Monkey Anti-Thyroid peroxidase antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Anti-Thyroid peroxidase antibody ELISA Kit
MBS750004-03 5x 96 Well

Monkey Anti-Thyroid peroxidase antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Anti-Thyroid peroxidase antibody ELISA Kit
MBS750004-04 10x 96 Well

Monkey Anti-Thyroid peroxidase antibody ELISA Kit

Sign In for Pricing
View Details