Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2W Peptide - C-terminal region

UBE2W Peptide - C-terminal region

Product Specifications

Product Name Alternative

UBC16, UBC-16

UniProt

Q96B02

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060769.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM2D2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV703419 1.0 µg DNA

TM2D2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-PTPN7 (Ser93) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5558R-PE-Cy5 100 µL

Phospho-PTPN7 (Ser93) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PNMAL2 Protein Vector (Human) (pPB-C-His)
PV112066 500 ng

PNMAL2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Sh3gl2 3'UTR Lenti-reporter-Luc Vector
43677084 1.0 µg

Sh3gl2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ITCH Knockout HCT116 Polyclonal Cells
ARG34838 1 Million

ITCH Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Polyclonal SCC112 Antibody [PerCP]
NBP2-98627PCP 0.1 mL

Rabbit Polyclonal SCC112 Antibody [PerCP]

Sign In for Pricing
View Details