Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2W Peptide - C-terminal region

UBE2W Peptide - C-terminal region

Product Specifications

Product Name Alternative

UBC16, UBC-16

UniProt

Q96B02

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060769.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1519 shRNA (m) Lentiviral Particles
sc-150636-V 200 µL

Olfr1519 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
KRT9 Antibody
orb1560779-01 50 µL

KRT9 Antibody

Sign In for Pricing
View Details
KRT9 Antibody
orb1560779-02 100 µL

KRT9 Antibody

Sign In for Pricing
View Details
KRT9 Antibody
orb1560779-03 200 µL

KRT9 Antibody

Sign In for Pricing
View Details
Mmu-miR-6351 miRNA Antagomir
CIN1159-01 10 nmol

Mmu-miR-6351 miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-6351 miRNA Antagomir
CIN1159-02 20 nmol

Mmu-miR-6351 miRNA Antagomir

Sign In for Pricing
View Details