Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D3 Peptide - middle region

CACNA2D3 Peptide - middle region

Product Specifications

Product Name Alternative

HSA272268

UniProt

Q8IZS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eprosartan 10mM * 1mL in DMSO
A11121-10mM-D 10 mM x 1mL in DMSO

Eprosartan 10mM * 1mL in DMSO

Sign In for Pricing
View Details
PUM3 Polyclonal Antibody
MBS2560074-01 0.02 mL

PUM3 Polyclonal Antibody

Sign In for Pricing
View Details
PUM3 Polyclonal Antibody
MBS2560074-02 0.06 mL

PUM3 Polyclonal Antibody

Sign In for Pricing
View Details
PUM3 Polyclonal Antibody
MBS2560074-03 0.12 mL

PUM3 Polyclonal Antibody

Sign In for Pricing
View Details
PUM3 Polyclonal Antibody
MBS2560074-04 0.2 mL

PUM3 Polyclonal Antibody

Sign In for Pricing
View Details
PUM3 Polyclonal Antibody
MBS2560074-05 5x 0.2 mL

PUM3 Polyclonal Antibody

Sign In for Pricing
View Details