What is the catalog number for TRPC7 Peptide - C-terminal region?

The catalog number for TRPC7 Peptide - C-terminal region is orb1999658.

What sizes are available for TRPC7 Peptide - C-terminal region?

TRPC7 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TRPC7 Peptide - C-terminal region in stock?

TRPC7 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TRPC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAA76997-01 250 mg

2,6-Dioxo-1,2,3,6-tetrahydropyrimidine-4-carboxamide

Sign In for Pricing

View Details

AAA76997-02 2.5 g

2,6-Dioxo-1,2,3,6-tetrahydropyrimidine-4-carboxamide

Sign In for Pricing

View Details

MBS9615264-01 1 mg

Phospho-PAK1 /PAK2 (Ser199/Ser204, Ser192/Ser197) Blocking Peptide

Sign In for Pricing

View Details

MBS9615264-02 5x 1 mg

Phospho-PAK1 /PAK2 (Ser199/Ser204, Ser192/Ser197) Blocking Peptide

Sign In for Pricing

View Details

NBP2-71416B 0.1 mL

Mouse Monoclonal Claudin-6 Antibody (OTI2H1) [Biotin]

Sign In for Pricing

View Details

GWB-MM843F 50 µg

NR1H3 Antibody

Sign In for Pricing

View Details