What is the catalog number for TRPC7 Peptide - C-terminal region?

The catalog number for TRPC7 Peptide - C-terminal region is orb1999658.

What sizes are available for TRPC7 Peptide - C-terminal region?

TRPC7 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TRPC7 Peptide - C-terminal region in stock?

TRPC7 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TRPC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LS009524 100 µg

GPSN2 (TECR) (NM_138501) Human Over-expression Lysate

Sign In for Pricing

View Details

AMM19243VCF 100 µg

SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: LBI5C8]

Sign In for Pricing

View Details

bs-1746R-BF555 100 µL

Dopamine D4 receptor Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing

View Details

60R-IR008 0.025 mg

IL6 antibody (biotin)

Sign In for Pricing

View Details

244419-ML750 100 µL

CD74 (CD74 Molecule, Major Histocompatibility Complex, Class II invariant Chain, DHLAG, HLADG, Ia-GAMMA) (MaxLight 750) discontinued

Sign In for Pricing

View Details

orb1681935 5 mg

Patulitrin

Sign In for Pricing

View Details