Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC7 Peptide - C-terminal region

TRPC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA1 Recombinant Antibody, HRP Conjugated
bsm-62287R-HRP-TR 20 µL

FRA1 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
C-Maf (h) -PR
sc-38111-PR 10 µM - 20 µL

C-Maf (h) -PR

Sign In for Pricing
View Details
CDw75 (FITC)
C2586-01G 120 Tests

CDw75 (FITC)

Sign In for Pricing
View Details
Cyclin E1 Rabbit mAb
MBS9147761-01 0.02 mL

Cyclin E1 Rabbit mAb

Sign In for Pricing
View Details
Cyclin E1 Rabbit mAb
MBS9147761-02 0.1 mL

Cyclin E1 Rabbit mAb

Sign In for Pricing
View Details
Cyclin E1 Rabbit mAb
MBS9147761-03 5x 0.1 mL

Cyclin E1 Rabbit mAb

Sign In for Pricing
View Details