What is the catalog number for ATP8B2 Peptide - N-terminal region?

The catalog number for ATP8B2 Peptide - N-terminal region is orb1999657.

What sizes are available for ATP8B2 Peptide - N-terminal region?

ATP8B2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is ATP8B2 Peptide - N-terminal region in stock?

ATP8B2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ATP8B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATPID

UniProt

P98198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPEKWARAQAPPSWSRKKPSWGTEEERRARANDREYNEKFQYASNCIKTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-20426 0.1 mL

Rabbit Polyclonal SMPD1 Antibody

Sign In for Pricing

View Details

orb1948424-01 48 Tests

Human Complement Factor H Related Protein 2 (CFHR2) ELISA Kit

Sign In for Pricing

View Details

orb1948424-02 96 Tests

Human Complement Factor H Related Protein 2 (CFHR2) ELISA Kit

Sign In for Pricing

View Details

ARP41297_P050-25UL 25 µL

VANGL1 Antibody - N-terminal region

Sign In for Pricing

View Details

sc-62848-V 200 µL

PP4R1 shRNA (h) Lentiviral Particles

Sign In for Pricing

View Details

E016394-01 1 Each

Human GHR ELISA Kit

Sign In for Pricing

View Details