Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP8B2 Peptide - N-terminal region

ATP8B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATPID

UniProt

P98198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPEKWARAQAPPSWSRKKPSWGTEEERRARANDREYNEKFQYASNCIKTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit
MBS761541-01 48 Well

Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit
MBS761541-02 96 Well

Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit
MBS761541-03 5x 96 Well

Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit
MBS761541-04 10x 96 Well

Human Tumor necrosis factor receptor superfamily member 13C ELISA Kit

Sign In for Pricing
View Details
CPLA2 beta Polyclonal Antibody, APC-Cy7 Conjugated
bs-3780R-APC-Cy7 100 µL

CPLA2 beta Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Goat anti-MRPL3 Antibody
MBS420321-01 0.1 mg

Goat anti-MRPL3 Antibody

Sign In for Pricing
View Details