PPP4R3B Peptide - C-terminal region
PPP4R3B Peptide - C-terminal region
Product Specifications
Product Name Alternative
PSY2, smk1, FLFL2, SMEK2, PP4R3B
UniProt
Q5MIZ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_065196.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Cr2666-inquire Inquire
Recombinant Vibrio Cholerae lpoA Protein (aa 1-603) (strain M66-2)
Sign In for Pricing
View Details 
E28M2440 100 µL
Phosphomevalonate kinase (15F17) Rabbit Monoclonal Antibody
Sign In for Pricing
View Details bsm-61211R-BF488-01 20 µL
TOMM20 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
Sign In for Pricing
View Details bsm-61211R-BF488-02 100 µL
TOMM20 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
Sign In for Pricing
View Details 
GTR15209655 1 Vial
Lentiviral mouse Sh3bp1 shRNA (UAS) - Lentiviral mouse Sh3bp1 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details