PPP4R3B Peptide - C-terminal region
PPP4R3B Peptide - C-terminal region
Product Specifications
Product Name Alternative
PSY2, smk1, FLFL2, SMEK2, PP4R3B
UniProt
Q5MIZ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_065196.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
IL-0361-HP-1000 1000 g
Poly (diallyldimethylammonium bis (trifluoromethylsulfonyl) imide
Sign In for Pricing
View Details 
BNUB1058-500 1x 500 µL
Human Papillomavirus 16 (HPV-16) (HPV16/1058), 0.2mg/mL
Sign In for Pricing
View Details 
orb2510342 100 µL
C1ORF190 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details NBP2-71259V 0.1 mL
Mouse Monoclonal JNK2 Antibody (OTI1A1) [DyLight 405]
Sign In for Pricing
View Details 
MBS1098765-01 0.02 mg (E-Coli)
Recombinant Francisella philomiragia subsp. philomiragia Pantothenate synthetase (panC)
Sign In for Pricing
View Details MBS1098765-02 0.02 mg (Yeast)
Recombinant Francisella philomiragia subsp. philomiragia Pantothenate synthetase (panC)
Sign In for Pricing
View Details