Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KXD1 Peptide - C-terminal region

KXD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KXDL, BORCS4, MST096, MSTP096, C10orf50, C19orf50

UniProt

Q9BQD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001165419.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), Biotin conjugate, 0.1mg/mL
BNCB2145-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
THEM5 (NM_182578) Human Recombinant Protein
TP310954L 1 mg

THEM5 (NM_182578) Human Recombinant Protein

Sign In for Pricing
View Details
4-O-beta-Glucopyranosyl-cis-coumaric alphacid (>80%)
TRC-G419040-1MG 1 mg

4-O-beta-Glucopyranosyl-cis-coumaric alphacid (>80%)

Sign In for Pricing
View Details
N-Nitroso Chloroquine
TRC-N132090-100MG 100 mg

N-Nitroso Chloroquine

Sign In for Pricing
View Details
Platelets Mouse Monoclonal Antibody [Clone ID: BR4]
AM26066PU-N 100 µg

Platelets Mouse Monoclonal Antibody [Clone ID: BR4]

Sign In for Pricing
View Details
N-Carboxybenzyl Valbenazine
TRC-C178125-5MG 5 mg

N-Carboxybenzyl Valbenazine

Sign In for Pricing
View Details