Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KXD1 Peptide - C-terminal region

KXD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KXDL, BORCS4, MST096, MSTP096, C10orf50, C19orf50

UniProt

Q9BQD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001165419.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]
TA500730AM 100 µL

BTN3A2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]

Sign In for Pricing
View Details
N-Nitrosodiethylamine-d10
TRC-N525466-5MG 5 mg

N-Nitrosodiethylamine-d10

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714636 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Ephrin A3 (EFNA3) Rabbit Polyclonal Antibody
TA361506 100 µL

Ephrin A3 (EFNA3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSGR (OR51E2) (NM_030774) Human Recombinant Protein
TP304752 20 µg

PSGR (OR51E2) (NM_030774) Human Recombinant Protein

Sign In for Pricing
View Details
DPP4/CD26 Polyclonal Antibody
AN006840L-01 25 µL

DPP4/CD26 Polyclonal Antibody

Sign In for Pricing
View Details