Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTK2 Peptide - middle region

PTK2 Peptide - middle region

Product Specifications

Product Name Alternative

FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK

UniProt

Q05397

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186578.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-5103 miRNA Agomir
orb1917922-01 5 nmol

Mmu-miR-5103 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-5103 miRNA Agomir
orb1917922-02 10 nmol

Mmu-miR-5103 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-5103 miRNA Agomir
orb1917922-03 20 nmol

Mmu-miR-5103 miRNA Agomir

Sign In for Pricing
View Details
KAT6A siRNA (Rat)
CRR5051-01 15 nmol

KAT6A siRNA (Rat)

Sign In for Pricing
View Details
KAT6A siRNA (Rat)
CRR5051-02 30 nmol

KAT6A siRNA (Rat)

Sign In for Pricing
View Details
Sulfuric acid Standard volumetric solution 0.1 M (0.2 N)
LC-6023.1 1 L

Sulfuric acid Standard volumetric solution 0.1 M (0.2 N)

Sign In for Pricing
View Details