Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTK2 Peptide - middle region

PTK2 Peptide - middle region

Product Specifications

Product Name Alternative

FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK

UniProt

Q05397

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186578.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFB1 Protein Vector (Mouse) (pPB-N-His)
PV237903 500 ng

TGFB1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Agistatin D
B1022-1 1 mg

Agistatin D

Sign In for Pricing
View Details
SMCR7L Antibody Blocking Peptide
orb1513959 500 µg

SMCR7L Antibody Blocking Peptide

Sign In for Pricing
View Details
Map2k6, NT (Map2k6, Prkmk6, Sapkk3, Dual specificity mitogen-activated protein kinase kinase 6, MAPK/ERK kinase 6, SAPKK3) (Azide free) (HRP) discontinued
038134-HRP 200 µL

Map2k6, NT (Map2k6, Prkmk6, Sapkk3, Dual specificity mitogen-activated protein kinase kinase 6, MAPK/ERK kinase 6, SAPKK3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
PLAU, 21-431aa, Human, His tag, Baculovirus
MBS206389-01 0.01 mg

PLAU, 21-431aa, Human, His tag, Baculovirus

Sign In for Pricing
View Details
PLAU, 21-431aa, Human, His tag, Baculovirus
MBS206389-02 0.02 mg

PLAU, 21-431aa, Human, His tag, Baculovirus

Sign In for Pricing
View Details