What is the catalog number for PTK2 Peptide - middle region?

The catalog number for PTK2 Peptide - middle region is orb1999651.

What sizes are available for PTK2 Peptide - middle region?

PTK2 Peptide - middle region is available in the following size(s): 100 µg.

Is PTK2 Peptide - middle region in stock?

PTK2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PTK2 Peptide - middle region

Product Specifications

Product Name Alternative

FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK

UniProt

Q05397

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186578.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABP-S-051411 5 Plates

Mouse AHSP Matched Antibody Pair Set [ABP-S-051411]

Sign In for Pricing

View Details

SC303436 10 µg

GIP (NM_004123) Human Untagged Clone

Sign In for Pricing

View Details

226910-Biotin 100 µL

Dengue NS1 (Subtype 1, Dengue virus NS1, NS1) (Biotin)

Sign In for Pricing

View Details

DD37503 1 Each

Plastic box for 100 microscope slides (red colour)

Sign In for Pricing

View Details

LC413482 20 µg

AKIP (AURKAIP1) (NM_017900) Human Over-expression Lysate

Sign In for Pricing

View Details

S-3660 1 mL

Silvex - 1ML

Sign In for Pricing

View Details