Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRIP1 Peptide - N-terminal region

BRIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OF, BACH1, FANCJ

UniProt

Q9BX63

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_114432.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSAKKQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raver2 (NM_001191867) Rat Tagged ORF Clone
RR217091 10 µg

Raver2 (NM_001191867) Rat Tagged ORF Clone

Sign In for Pricing
View Details
CBX5 (Chromobox Homolog 5, Drosophila HP1 alpha Homolog) discontinued
C2098-85 50 µg

CBX5 (Chromobox Homolog 5, Drosophila HP1 alpha Homolog) discontinued

Sign In for Pricing
View Details
EV71 3C Rabbit pAb
E45R30399N 50 ul

EV71 3C Rabbit pAb

Sign In for Pricing
View Details
Serpine2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6928504 1.0 µg DNA

Serpine2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone 2D8]
E45M15416V-2 50 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone 2D8]

Sign In for Pricing
View Details
TMEM59 Rabbit Polyclonal Antibody (Cy3)
orb2589843 100 µg

TMEM59 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details