What is the catalog number for BRIP1 Peptide - N-terminal region?

The catalog number for BRIP1 Peptide - N-terminal region is orb1999648.

What sizes are available for BRIP1 Peptide - N-terminal region?

BRIP1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is BRIP1 Peptide - N-terminal region in stock?

BRIP1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

BRIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OF, BACH1, FANCJ

UniProt

Q9BX63

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_114432.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSAKKQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS9340349-01 48 Well

Rat Mitochondrial inner membrane protein, IMMT ELISA Kit

Sign In for Pricing

View Details

MBS9340349-02 96 Well

Rat Mitochondrial inner membrane protein, IMMT ELISA Kit

Sign In for Pricing

View Details

MBS9340349-03 5x 96 Well

Rat Mitochondrial inner membrane protein, IMMT ELISA Kit

Sign In for Pricing

View Details

MBS9340349-04 10x 96 Well

Rat Mitochondrial inner membrane protein, IMMT ELISA Kit

Sign In for Pricing

View Details

NBP2-99137V 0.1 mL

Rabbit Polyclonal DACH2 Antibody [DyLight 405]

Sign In for Pricing

View Details

MBS3230355-01 0.1 mg

PRPF8 Peptide - N-terminal region

Sign In for Pricing

View Details