Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT Peptide - middle region

HNMT Peptide - middle region

Product Specifications

Product Name Alternative

HMT, HNMT-S1, HNMT-S2

UniProt

P50135

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019245.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Follicle Stimulating Hormone, beta (FSH) (MaxLight 405)
MBS6263538-01 0.1 mL

Follicle Stimulating Hormone, beta (FSH) (MaxLight 405)

Sign In for Pricing
View Details
Follicle Stimulating Hormone, beta (FSH) (MaxLight 405)
MBS6263538-02 5x 0.1 mL

Follicle Stimulating Hormone, beta (FSH) (MaxLight 405)

Sign In for Pricing
View Details
GFAP Antibody
orb1325895 100 µg

GFAP Antibody

Sign In for Pricing
View Details
NOR-1 (H-7) Alexa Fluor® 680
sc-393902 AF680 200 µg/mL

NOR-1 (H-7) Alexa Fluor® 680

Sign In for Pricing
View Details
RGS4 Antibody; Biotin conjugated
MBS7004916-01 0.05 mg

RGS4 Antibody; Biotin conjugated

Sign In for Pricing
View Details
RGS4 Antibody; Biotin conjugated
MBS7004916-02 0.1 mg

RGS4 Antibody; Biotin conjugated

Sign In for Pricing
View Details