Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT Peptide - middle region

HNMT Peptide - middle region

Product Specifications

Product Name Alternative

HMT, HNMT-S1, HNMT-S2

UniProt

P50135

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019245.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Neurokinin B ELISA Kit
MBS751462-01 48 Well

Guinea pig Neurokinin B ELISA Kit

Sign In for Pricing
View Details
Guinea pig Neurokinin B ELISA Kit
MBS751462-02 96 Well

Guinea pig Neurokinin B ELISA Kit

Sign In for Pricing
View Details
Guinea pig Neurokinin B ELISA Kit
MBS751462-03 5x 96 Well

Guinea pig Neurokinin B ELISA Kit

Sign In for Pricing
View Details
Guinea pig Neurokinin B ELISA Kit
MBS751462-04 10x 96 Well

Guinea pig Neurokinin B ELISA Kit

Sign In for Pricing
View Details
BMP5 (Bone Morphogenetic Protein 5, MGC34244)
243824 200 µL

BMP5 (Bone Morphogenetic Protein 5, MGC34244)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) ACCD Polyclonal Antibody
MBS7188818 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) ACCD Polyclonal Antibody

Sign In for Pricing
View Details