Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTB Peptide - N-terminal region

ACTB Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRWS1, PS1TP5BP1

UniProt

P63261

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186883.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trovafloxacin mesylate
MBS3615117-01 5 mg

Trovafloxacin mesylate

Sign In for Pricing
View Details
Trovafloxacin mesylate
MBS3615117-02 10 mg

Trovafloxacin mesylate

Sign In for Pricing
View Details
Trovafloxacin mesylate
MBS3615117-03 25 mg

Trovafloxacin mesylate

Sign In for Pricing
View Details
Trovafloxacin mesylate
MBS3615117-04 50 mg

Trovafloxacin mesylate

Sign In for Pricing
View Details
Trovafloxacin mesylate
MBS3615117-05 100 mg

Trovafloxacin mesylate

Sign In for Pricing
View Details
Trovafloxacin mesylate
MBS3615117-06 5x 100 mg

Trovafloxacin mesylate

Sign In for Pricing
View Details