LPAR2 Peptide - N-terminal region
LPAR2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EDG4, LPA2, EDG-4, LPA-2
UniProt
Q9HBW0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004711.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2442498 100 µL
Endothelial lipase Rabbit Polyclonal Antibody (BF594)
Sign In for Pricing
View Details 
bs-6245R-PE-Cy5-TR 20 µL
Wnt8b Polyclonal Antibody, PE-Cy5 Conjugated
Sign In for Pricing
View Details 
431978-01 100 mg
4-Cyanomethoxy-3,5-dimethylphenylboronic acid pinacol ester
Sign In for Pricing
View Details 431978-02 250 mg
4-Cyanomethoxy-3,5-dimethylphenylboronic acid pinacol ester
Sign In for Pricing
View Details LV686285 1.0 µg DNA
MOG Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details