What is the catalog number for LPAR2 Peptide - N-terminal region?

The catalog number for LPAR2 Peptide - N-terminal region is orb1999645.

What sizes are available for LPAR2 Peptide - N-terminal region?

LPAR2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is LPAR2 Peptide - N-terminal region in stock?

LPAR2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

LPAR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDG4, LPA2, EDG-4, LPA-2

UniProt

Q9HBW0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004711.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YF-PA25444 50 ul

anti-CLEC2B

Sign In for Pricing

View Details

NBP3-20908UV 0.1 mL

Rabbit Monoclonal Cytokeratin 17 Antibody (KRT17/8320R) [DyLight 350]

Sign In for Pricing

View Details

NB820-60590 0.1 mg

Human Epididymis Membrane Tissue Lysate (Adult Membrane Normal) - (Dry Ice)

Sign In for Pricing

View Details

MBS4165870-01 0.1 mL

SensiStain Anti-EZH2 Antibody

Sign In for Pricing

View Details

MBS4165870-02 5x 0.1 mL

SensiStain Anti-EZH2 Antibody

Sign In for Pricing

View Details

sc-152843-V 200 µL

RhAG shRNA (m) Lentiviral Particles

Sign In for Pricing

View Details