Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHD1 Peptide - N-terminal region

EFHD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SWS2, MST133, PP3051, MSTP133

UniProt

Q9BUP0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230181.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1E Antibody (C-term)
MBS9210164-01 0.08 mL

CSNK1E Antibody (C-term)

Sign In for Pricing
View Details
CSNK1E Antibody (C-term)
MBS9210164-02 0.4 mL

CSNK1E Antibody (C-term)

Sign In for Pricing
View Details
CSNK1E Antibody (C-term)
MBS9210164-03 5x 0.4 mL

CSNK1E Antibody (C-term)

Sign In for Pricing
View Details
SERPINB8 Rabbit Polyclonal Antibody (Fluoro488)
orb3095466 100 µg

SERPINB8 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
IFRD1 siRNA (Rat)
CRR1264-01 15 nmol

IFRD1 siRNA (Rat)

Sign In for Pricing
View Details
IFRD1 siRNA (Rat)
CRR1264-02 30 nmol

IFRD1 siRNA (Rat)

Sign In for Pricing
View Details