Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHD1 Peptide - N-terminal region

EFHD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SWS2, MST133, PP3051, MSTP133

UniProt

Q9BUP0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230181.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD320 (CD320 Molecule, 8D6, 8D6A)
244367 200 µL

CD320 (CD320 Molecule, 8D6, 8D6A)

Sign In for Pricing
View Details
VAMP5 Polyclonal Antibody, Biotin Conjugated
A63783-100 100 µL

VAMP5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Influenza A H1N1 protein (Taiwan)
30R-AI038 1 mg

Influenza A H1N1 protein (Taiwan)

Sign In for Pricing
View Details
Human Cystatin S (CST4) ELISA Kit
MBS7218692-01 48 Well

Human Cystatin S (CST4) ELISA Kit

Sign In for Pricing
View Details
Human Cystatin S (CST4) ELISA Kit
MBS7218692-02 96 Well

Human Cystatin S (CST4) ELISA Kit

Sign In for Pricing
View Details
Human Cystatin S (CST4) ELISA Kit
MBS7218692-03 5x 96 Well

Human Cystatin S (CST4) ELISA Kit

Sign In for Pricing
View Details