Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC9 Peptide - middle region

EXOSC9 Peptide - middle region

Product Specifications

Product Name Alternative

P5, p6, RRP45, PMSCL1, Rrp45p, PM/Scl-75

UniProt

Q06265

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001029366.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEGGGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POP5 Protein Vector (Rat) (pPM-C-HA)
PV295264 500 ng

POP5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NFAT4 (phospho-S165) peptide
orb257006-01 1 mg

NFAT4 (phospho-S165) peptide

Sign In for Pricing
View Details
NFAT4 (phospho-S165) peptide
orb257006-02 5 mg

NFAT4 (phospho-S165) peptide

Sign In for Pricing
View Details
Guinea pig Transcription factor Sp8 (SP8) ELISA Kit
MBS7238755-01 48 Well

Guinea pig Transcription factor Sp8 (SP8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transcription factor Sp8 (SP8) ELISA Kit
MBS7238755-02 96 Well

Guinea pig Transcription factor Sp8 (SP8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transcription factor Sp8 (SP8) ELISA Kit
MBS7238755-03 5x 96 Well

Guinea pig Transcription factor Sp8 (SP8) ELISA Kit

Sign In for Pricing
View Details