Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL7A Peptide - middle region

ACTL7A Peptide - middle region

Product Specifications

UniProt

Q9Y615

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006678.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Rabbit Anti-Mouse IgG
RD90801A-01 120 μL

Biotin-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details
Biotin-Rabbit Anti-Mouse IgG
RD90801A-02 500 µL

Biotin-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details
Biotin-Rabbit Anti-Mouse IgG
RD90801A-03 1 mL

Biotin-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details
1,2-Distearoyl-sn-glycerol
TRC-D493515-500MG 500 mg

1,2-Distearoyl-sn-glycerol

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS803477 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Chk2 (CHEK2) (514-518) Rabbit Polyclonal Antibody
AP26045PU-S 50 µL

Chk2 (CHEK2) (514-518) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details