Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL7A Peptide - middle region

ACTL7A Peptide - middle region

Product Specifications

UniProt

Q9Y615

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006678.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DPP4 Antibody Pair Set
E-KAB-0574 50 µL & 100 µg

Mouse DPP4 Antibody Pair Set

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen,  20nm
GM-47-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen, 20nm

Sign In for Pricing
View Details
HSD11B1 Rabbit Polyclonal Antibody
TA377230 100 µL

HSD11B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIO1 Polyclonal Antibody
E-AB-14929-01 20 µL

DIO1 Polyclonal Antibody

Sign In for Pricing
View Details
DIO1 Polyclonal Antibody
E-AB-14929-02 60 µL

DIO1 Polyclonal Antibody

Sign In for Pricing
View Details
DIO1 Polyclonal Antibody
E-AB-14929-03 120 µL

DIO1 Polyclonal Antibody

Sign In for Pricing
View Details