Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPI Peptide - N-terminal region

BPI Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBPI, BPIFD1

UniProt

P17213

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001716.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Double Stranded DNA (dsDNA) (DSD/958), 0.2mg/mL
BNUB0958-100 1x 100 µL

Double Stranded DNA (dsDNA) (DSD/958), 0.2mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338G-01 50 Tests

PE/Cyanine5 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details
PE/Cyanine5 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338G-02 100 Tests

PE/Cyanine5 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details
PE/Cyanine5 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338G-03 2x 100 Tests

PE/Cyanine5 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB600829 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
TMF1 Rabbit Monoclonal Antibody [Clone ID: 24GB1965]
TA425270 100 µL

TMF1 Rabbit Monoclonal Antibody [Clone ID: 24GB1965]

Sign In for Pricing
View Details