Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPI Peptide - N-terminal region

BPI Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBPI, BPIFD1

UniProt

P17213

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001716.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF405S conjugate, 0.1mg/mL
BNC043788-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentachlorothioanisole
TRC-P238170-1G 1 g

Pentachlorothioanisole

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF488A conjugate, 0.1mg/mL
BNC882550-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ACRC (GCNA) activation kit by CRISPRa
GA114304 1 Kit

Human ACRC (GCNA) activation kit by CRISPRa

Sign In for Pricing
View Details
Potassium (3-Aminophenyl)trifluoroborate
TRC-P991485-50MG 50 mg

Potassium (3-Aminophenyl)trifluoroborate

Sign In for Pricing
View Details
DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)
KN201759LP 1 Kit

DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details