Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBEGF Peptide - N-terminal region

HBEGF Peptide - N-terminal region

Product Specifications

Product Name Alternative

DTR, DTS, DTSF, HEGFL

UniProt

Q99075

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001936.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CHEK2 (Thr68) Recombinant Antibody, Cy3 Conjugated
bsm-61583R-Cy3-TR 20 µL

Phospho-CHEK2 (Thr68) Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
DL-MBL-Ra-01 48 Tests

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
DL-MBL-Ra-02 96 Tests

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-OST48 Antibody
MBS4508403-01 0.05 mL

Rabbit anti-OST48 Antibody

Sign In for Pricing
View Details
Rabbit anti-OST48 Antibody
MBS4508403-02 0.1 mL

Rabbit anti-OST48 Antibody

Sign In for Pricing
View Details
Rabbit anti-OST48 Antibody
MBS4508403-03 5x 0.1 mL

Rabbit anti-OST48 Antibody

Sign In for Pricing
View Details