Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIRA Peptide - middle region

HIRA Peptide - middle region

Product Specifications

Product Name Alternative

TUP1, DGCR1, TUPLE1

UniProt

P54198

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003316.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Antibody
E55A11892 100 µg

DNA Antibody

Sign In for Pricing
View Details
Human PSMD6 Knockout A549 cell line
GTR15422001 1 Vial

Human PSMD6 Knockout A549 cell line

Sign In for Pricing
View Details
Human Herpes Virus-5 IgM Antibody ELISA Kit, Human
VACY-1022-CY274 1 Kit

Human Herpes Virus-5 IgM Antibody ELISA Kit, Human

Sign In for Pricing
View Details
Mouse Coiled coil domain containing protein 89 (CCDC89) ELISA kit
GTR10402070 96 Well

Mouse Coiled coil domain containing protein 89 (CCDC89) ELISA kit

Sign In for Pricing
View Details
Torilin
TN5153 5 mg

Torilin

Sign In for Pricing
View Details
AFF4 Protein Vector (Human) (pPB-C-His)
PV000917 500 ng

AFF4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details