Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARVCF Peptide - middle region

ARVCF Peptide - middle region

Product Specifications

UniProt

O00192

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001661.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26P44 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42332151 3x 1.0 µg DNA

RPS26P44 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
HSP22 Antibody (Biotin)
orb151981 100 µL

HSP22 Antibody (Biotin)

Sign In for Pricing
View Details
CSRP3 Rabbit Polyclonal Antibody
orb182781-01 50 μL

CSRP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CSRP3 Rabbit Polyclonal Antibody
orb182781-02 100 µL

CSRP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CSRP3 Rabbit Polyclonal Antibody
orb182781-03 200 µL

CSRP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human EXOC7 Pre-designed siRNA Set A
SI005215A 1 Each

Human EXOC7 Pre-designed siRNA Set A

Sign In for Pricing
View Details