Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARVCF Peptide - middle region

ARVCF Peptide - middle region

Product Specifications

UniProt

O00192

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001661.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Legionella Pneumophila tmk Protein (aa 1-212)
VAng-Lsx3751-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila tmk Protein (aa 1-212)

Sign In for Pricing
View Details
Monkey Carbonhyde Antigen 125 (CA125) ELISA Kit
GTR10357932 96 Well

Monkey Carbonhyde Antigen 125 (CA125) ELISA Kit

Sign In for Pricing
View Details
Anti-BSEP Antibody
CQA3469-01 30 µL

Anti-BSEP Antibody

Sign In for Pricing
View Details
Anti-BSEP Antibody
CQA3469-02 50 μL

Anti-BSEP Antibody

Sign In for Pricing
View Details
Anti-BSEP Antibody
CQA3469-03 100 µL

Anti-BSEP Antibody

Sign In for Pricing
View Details
Anti-BSEP Antibody
CQA3469-04 200 µL

Anti-BSEP Antibody

Sign In for Pricing
View Details