Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Type VII secretion system extracellular protein A (esxA)

Product Specifications

CAS Number

9000-83-3

Gene Name

esxA

UniProt

Q6GCJ0

Expression Region

1-97aa

Organism

Staphylococcus aureus (strain MSSA476)

Target Sequence

MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Field of Research

Others

Assay Type

Developed Protein

Relevance

Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion . Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity .

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.0 kDa

References & Citations

"Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance."Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium D-Gluconate-1-13C
TRC-S634002-10MG 10 mg

Sodium D-Gluconate-1-13C

Sign In for Pricing
View Details
Fmoc-Asn (Trt) Wang Resin LL
HLL0751501304.25G 25 g

Fmoc-Asn (Trt) Wang Resin LL

Sign In for Pricing
View Details
GUCY1A2 Human Gene Knockout Kit (CRISPR)
KN419523 1 Kit

GUCY1A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Angiopoietin-2 Antibody
RC-4084-01 50 μL

Recombinant Angiopoietin-2 Antibody

Sign In for Pricing
View Details
Recombinant Angiopoietin-2 Antibody
RC-4084-02 100 µL

Recombinant Angiopoietin-2 Antibody

Sign In for Pricing
View Details
Recombinant Angiopoietin-2 Antibody
RC-4084-03 1 mL

Recombinant Angiopoietin-2 Antibody

Sign In for Pricing
View Details