Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAC2 Peptide - N-terminal region

ELAC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ELC2, HPC2, COXPD17

UniProt

Q9BQ52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159434.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Automation Reservoirs
RES19MC-12-N 50 Pack/Case

Automation Reservoirs

Sign In for Pricing
View Details
Ki67 Antibody
KC-15444-01 50 μL

Ki67 Antibody

Sign In for Pricing
View Details
Ki67 Antibody
KC-15444-02 100 µL

Ki67 Antibody

Sign In for Pricing
View Details
Ki67 Antibody
KC-15444-03 1 mL

Ki67 Antibody

Sign In for Pricing
View Details
Human PANK4 activation kit by CRISPRa
GA110626 1 Kit

Human PANK4 activation kit by CRISPRa

Sign In for Pricing
View Details
DSN1 (NM_001145318) Human Over-expression Lysate
LY428821 100 µg

DSN1 (NM_001145318) Human Over-expression Lysate

Sign In for Pricing
View Details