Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3GAP1 Peptide - middle region

RAB3GAP1 Peptide - middle region

Product Specifications

Product Name Alternative

P130, WARBM1, RAB3GAP, RAB3GAP130

UniProt

Q15042

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001165906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLTPLPPVSIAIRFTYVLQDWQQYFWPQQPPDIDALVGGEVGGLEFGKLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 14 Recombinant Rabbit monoclonal Antibody
HA750216 100 µL

Cytokeratin 14 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AVPI1 (NM_021732) Human Over-expression Lysate
LC402873 20 µg

AVPI1 (NM_021732) Human Over-expression Lysate

Sign In for Pricing
View Details
IL13 (NM_002188) Human Recombinant Protein
TP723715 10 µg

IL13 (NM_002188) Human Recombinant Protein

Sign In for Pricing
View Details
CD45RA (158-4D3), CF568 conjugate, 0.1mg/mL
BNC680028-100 1x 100 µL

CD45RA (158-4D3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RBM12B Antibody
KC-41672-01 50 μL

RBM12B Antibody

Sign In for Pricing
View Details
RBM12B Antibody
KC-41672-02 100 µL

RBM12B Antibody

Sign In for Pricing
View Details